PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr007170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family Dof
Protein Properties Length: 324aa    MW: 34900.1 Da    PI: 7.5874
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr007170.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.91e-383190261
       zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                 +++alkcprCds +tkfCyynny+lsqPr+fCkaCrryWtkGG lrnvPvGgg+rk k+s
  Pbr007170.1 31 NQQALKCPRCDSLHTKFCYYNNYNLSQPRHFCKACRRYWTKGGVLRNVPVGGGCRKTKRS 90
                 57899****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-243084IPR003851Zinc finger, Dof-type
PfamPF027017.0E-333389IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3393589IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103773IPR003851Zinc finger, Dof-type
Gene3DG3DSA:1.10.565.107.7E-459132IPR000536Nuclear hormone receptor, ligand-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043401Biological Processsteroid hormone mediated signaling pathway
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MQDIHSVRGG GRFFGGSGGG DRRLRPHQHP NQQALKCPRC DSLHTKFCYY NNYNLSQPRH  60
FCKACRRYWT KGGVLRNVPV GGGCRKTKRS KPKNSSSSSP TSSPPPPPPQ PNSAHQNKSS  120
SHSSSESSSL TNPAAAAEAV SAPSSTCSAS NLLTNIHNPE SKFFICQGGA NGGFEPGVSA  180
AALLEQSTEI NGMSSEIGSF TSLITSSNDV PFSFGNINGL PFDQQDQVGN HHHNQVHQNQ  240
WGQQNQEVKM QEISGGLLDQ TAQVDLSVFQ NRSNGVGGGE YGPLDWQPGS GDQGFFDLPN  300
TVDQAYWSQS QWADQDHPTL YLP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009337878.10.0PREDICTED: dof zinc finger protein DOF5.4-like
TrEMBLD9ZIX71e-161D9ZIX7_MALDO; DOF domain class transcription factor
STRINGPOPTR_0015s03520.15e-85(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.17e-31OBF binding protein 4